PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016506450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 428aa    MW: 46537.4 Da    PI: 4.5581
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016506450.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.13.5e-12188231247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        WT  E + l+++   +G + Wk++a+++g gR++k+c+ r+ k+
   XP_016506450.1 188 TDWTDKETLHLLEVLMHYGDD-WKKVAEHVG-GRSAKECVARFVKL 231
                      57*****************88.*********.**********9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129319.59185236IPR017884SANT domain
SuperFamilySSF466894.49E-13186240IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-9186228IPR009057Homeodomain-like
SMARTSM007175.0E-10186234IPR001005SANT/Myb domain
PfamPF002494.7E-12188231IPR001005SANT/Myb domain
CDDcd001671.03E-8190231No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MAETGDSKSP AANPNSETTS PPPPPPPPPP LQQPQHQPQT PSQPQLQPPP QTPSQPQPAP  60
QQPQTELLPP KCPQQLESSP NPTTPSATDS KDVTPTTLSS RLTEPDYIYI PSYSPPQNAD  120
ANGTTPTDFT APKKRLCSAC KSACSIACFV SDKYDLTLCA RCYVRGNFRV GMNTSDFRRV  180
EISEEVKTDW TDKETLHLLE VLMHYGDDWK KVAEHVGGRS AKECVARFVK LPFGEQFMGP  240
PVSAEVDNEP GSETILLPSK RMRLTPLADA SNPIMAQAAF LSALAGKEVA ELAAHAAVTA  300
LSDNGEGITK GSLGSLPGVL EKKESDGTSN GIAKDTLERA LVEARSQLEE EAQDLERAVS  360
DVAIEAKEIE DKIARFEERD LQMEKEWQQL MQLKNLIFFD QLTLLLNKVG SAKAGETIGE  420
EVMNVKAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016506450.10.0PREDICTED: SWI/SNF complex subunit SWI3B-like isoform X2
SwissprotQ84JG22e-87SWI3B_ARATH; SWI/SNF complex subunit SWI3B
TrEMBLA0A0V0ICA21e-172A0A0V0ICA2_SOLCH; Putative SWI/SNF complex subunit SWI3B-like
STRINGSolyc04g082760.2.11e-170(Solanum lycopersicum)